PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g066240.1
Common NameMTR_8g066240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 106aa    MW: 11308.7 Da    PI: 10.373
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g066240.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP48.22.8e-1564102442
                      STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE CS
              SBP   4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrf 42 
                      ++gC+adls+ + yh rhkvC+ hsk+++v++ g++qrf
  Medtr8g066240.1  64 ADGCQADLSNYRGYHMRHKVCKLHSKTSQVTLGGHKQRF 102
                      689***********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-1456103IPR004333Transcription factor, SBP-box
PROSITE profilePS5114112.38359105IPR004333Transcription factor, SBP-box
PfamPF031102.5E-1064102IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.68E-1464102IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MCANEFFVDL KLGHVGNSSA ESGLTKSKDV GGFTKITSSS SSTSGSSKKA RAINNGTQIV  60
SSLADGCQAD LSNYRGYHMR HKVCKLHSKT SQVTLGGHKQ RFFFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1447261e-178AC144726.6 Medicago truncatula chromosome 8 clone mth2-7k13, complete sequence.
GenBankAC1505051e-178AC150505.12 Medicago truncatula chromosome 8 clone mth2-99l2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003628740.11e-71squamosa promoter-binding 13A-like protein
TrEMBLG7LGA21e-71G7LGA2_MEDTR; Squamosa promoter-binding 13A-like protein
STRINGGLYMA05G38180.109e-30(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3189822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-16SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]